PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A09G2312
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 414aa    MW: 45049.1 Da    PI: 6.3805
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A09G2312genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_127.95e-09216265554
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                  kr++r   NR +A rs +RK  +i+eLe+k+++L++e ++L+ +l  l++
  Gh_A09G2312 216 KRAKRIWANRQSAARSKERKMRYIAELERKIQTLQTEATSLAAQLTLLQQ 265
                  9*****************************************99999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.5E-10212277IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.979214266IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.27E-10216265No hitNo description
PfamPF001705.9E-8216265IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.5E-7216265No hitNo description
CDDcd147039.64E-24217265No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
MEKDKSPCLP PMSGRVPGFS SSGNAANTSN TISETGNLGQ TSDSNRFSHD ISKMPDNPPK  60
NLGHRRAHSE IITLPDDINF DGDLGVVGAA DGPSYSDETE DDMLSMYLDI DKFNSSSVTS  120
MFQVAKSSAM TAPNSGPSAA VSMGAGTATS GEENASAGVG SSEKPRIRHQ HSQSMDGSTS  180
IKPEMLLSGS DEVTPADSKK AMSAAKLAEL ALIDPKRAKR IWANRQSAAR SKERKMRYIA  240
ELERKIQTLQ TEATSLAAQL TLLQQKDSTG MSAENSELKL RLQTMEQQVY LQDSLNDALK  300
EEIQHLKVLT AQPMPNGGPM MNFASFGASQ QYIPNNHAMQ ALLTAQQFQQ LQIQLQKHQH  360
QFPPHQLHQL QQQLQLQQEH QQQSGEMRVR GSMPSPNRRD GPSSSDVSST ASND
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.22750.0boll| ovule| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012487039.10.0PREDICTED: probable transcription factor PosF21
RefseqXP_012487040.10.0PREDICTED: probable transcription factor PosF21
SwissprotQ040881e-143POF21_ARATH; Probable transcription factor PosF21
TrEMBLA0A0D2S1150.0A0A0D2S115_G
STRINGVIT_05s0102g01120.t011e-163(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24452772
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.11e-119bZIP family protein